Structure of PDB 2lir Chain A

Receptor sequence

>2lirA (length=108) Species: 559292 (Saccharomyces cerevisiae S288C)

TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNHAKYIPGTKMAFGGLKKEKDRNDLI
TYLKKATE

3D structure

• PDB: 2lir Conformational toggling of yeast iso-1-cytochrome C in the oxidized and reduced States.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	R13 C14 C17 H18 P30 S40 Y48 T49 N52 W59 Y67 H71	R18 C19 C22 H23 P35 S45 Y53 T54 N57 W64 Y72 H76

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2lir, PDBe:2lir, PDBj:2lir
• PDBsum: 2lir
• PubMed: 22087268
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)