Structure of PDB 2lhi Chain A

Receptor sequence

>2lhiA (length=176) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVN
DLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGL
ISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSKGSS
TGTRRKALRNKILAIAKVSRMFSVLR

3D structure

PDB

2lhi Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

?
3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D20 D22 N24 S26 E31	D21 D23 N25 S27 E32
BS02	CA	A	D56 D58 N60 Q62 E64 E67	D57 D59 N61 Q63 E65 E68
BS03	CA	A	D93 N95 D97 L99 E104	D94 N96 D98 L100 E105

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0030234	enzyme regulator activity
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0051019	mitogen-activated protein kinase binding

	Biological Process
GO:0000742	karyogamy involved in conjugation with cellular fusion
GO:0006606	protein import into nucleus
GO:0006661	phosphatidylinositol biosynthetic process
GO:0006897	endocytosis
GO:0006898	receptor-mediated endocytosis
GO:0007010	cytoskeleton organization
GO:0007114	cell budding
GO:0010968	regulation of microtubule nucleation
GO:0016237	microautophagy
GO:0030050	vesicle transport along actin filament
GO:0042144	vacuole fusion, non-autophagic
GO:0051300	spindle pole body organization
GO:0071474	cellular hyperosmotic response
GO:1903525	regulation of membrane tubulation
GO:2000601	positive regulation of Arp2/3 complex-mediated actin nucleation

	Cellular Component
GO:0000131	incipient cellular bud site
GO:0005737	cytoplasm
GO:0005816	spindle pole body
GO:0005823	central plaque of spindle pole body
GO:0005856	cytoskeleton
GO:0005933	cellular bud
GO:0005934	cellular bud tip
GO:0005935	cellular bud neck
GO:0030479	actin cortical patch
GO:0031475	myosin V complex
GO:0043332	mating projection tip
GO:0045160	myosin I complex
GO:0051286	cell tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2lhi, PDBe:2lhi, PDBj:2lhi
PDBsum	2lhi
PubMed	22280008
UniProt	P06787\|CALM_YEAST Calmodulin (Gene Name=CMD1); P23287

[Back to BioLiP]