Structure of PDB 2lf1 Chain A

Receptor sequence

>2lf1A (length=162) Species: 1582 (Lacticaseibacillus casei)

TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFP
KRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGA
QIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPA
LTHTYEVWQKKA

3D structure

• PDB: 2lf1 NMR structures of apo L. casei dihydrofolate reductase and its complexes with trimethoprim and NADPH: contributions to positive cooperative binding from ligand-induced refolding, conformational changes, and interligand hydrophobic interactions
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): L4 L19 W21 D26 L27 F30 L54 L94 T116
• Catalytic site (residue number reindexed from 1): L4 L19 W21 D26 L27 F30 L54 L94 T116
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	I13 G14 D16 G17 H18 L19 G42 R43 R44 T45 L62 H64 H77 G99 A100 Q101 I102 T126	I13 G14 D16 G17 H18 L19 G42 R43 R44 T45 L62 H64 H77 G99 A100 Q101 I102 T126

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0031427 response to methotrexate
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2lf1, PDBe:2lf1, PDBj:2lf1
• PDBsum: 2lf1
• PubMed: 21410224
• UniProt: P00381|DYR_LACCA Dihydrofolate reductase (Gene Name=folA)