Structure of PDB 2lel Chain A

Receptor sequence

>2lelA (length=74) Species: 266264 (Cupriavidus metallidurans CH34)

VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGT
KIIMKGNEIFRLDEALRKGHSEGG

3D structure

• PDB: 2lel Molecular basis of the cooperative binding of Cu(I) and Cu(II) to the CopK protein from Cupriavidus metallidurans CH34.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU1	A	M28 M38 M44 M54	M28 M38 M44 M54
BS02	CU	A	V1 D2 H70	V1 D2 H70

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2lel, PDBe:2lel, PDBj:2lel
• PDBsum: 2lel
• PubMed: 21936507
• UniProt: Q58AD3|COPK_CUPMC Copper resistance protein K (Gene Name=copK)