Structure of PDB 2krb Chain A

Receptor sequence
>2krbA (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
DSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYI
FLEYASPAHAVDAVKNADGYKLDKQHTFRVN
3D structure
PDB2krb The indispensable N-terminal half of eIF3j/HCR1 co-operates with its structurally conserved binding partner eIF3b/PRT1-RRM and eIF1A in stringent AUG selection
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A K33 N36 V37 I38 K40 I41 G83 Y84 K85 L86 F92 K19 N22 V23 I24 K26 I27 G69 Y70 K71 L72 F78
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0031369 translation initiation factor binding
Biological Process
GO:0006413 translational initiation
Cellular Component
GO:0005852 eukaryotic translation initiation factor 3 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2krb, PDBe:2krb, PDBj:2krb
PDBsum2krb
PubMed
UniProtP55884|EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B (Gene Name=EIF3B)

[Back to BioLiP]