Structure of PDB 2kpi Chain A |
>2kpiA (length=56) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] |
MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVD EARRPE |
|
PDB | 2kpi Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C13 C16 C29 |
C13 C16 C29 |
|
|
|
|