Structure of PDB 2kot Chain A

Receptor sequence
>2kotA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLL
KDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
3D structure
PDB2kot Molecular level interactions of S100A13 with amlexanox: inhibitor for the formation of multi-protein complex in non-classical pathway of the acidic fibroblast growth factor
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ANW A M1 F21 R25 M1 F21 R25
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008289 lipid binding
GO:0017134 fibroblast growth factor binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0001819 positive regulation of cytokine production
GO:0008284 positive regulation of cell population proliferation
GO:0015031 protein transport
GO:0032730 positive regulation of interleukin-1 alpha production
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043303 mast cell degranulation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2kot, PDBe:2kot, PDBj:2kot
PDBsum2kot
PubMed20178375
UniProtQ99584|S10AD_HUMAN Protein S100-A13 (Gene Name=S100A13)

[Back to BioLiP]