Structure of PDB 2kos Chain A |
>2kosA (length=81) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] |
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAA EERFDVKIPDDDVKNLKTVGDATKYILDHQA |
|
PDB | 2kos Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D39 |
Catalytic site (residue number reindexed from 1) |
D39 |
Enzyme Commision number |
? |
|
|
|
|