Structure of PDB 2koq Chain A

Receptor sequence

>2koqA (length=81) Species: 1902 (Streptomyces coelicolor)

AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAA
EERFDVKIPDDDVKNLKTVGDATKYILDHQA

3D structure

• PDB: 2koq Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): D39
• Catalytic site (residue number reindexed from 1): D39

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SHW	A	F32 T33 S40 M43 V63 K64 L66 K67	F32 T33 S40 M43 V63 K64 L66 K67

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0009245 lipid A biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2koq, PDBe:2koq, PDBj:2koq
• PDBsum: 2koq
• PubMed: 20659690
• UniProt: P72393