Structure of PDB 2kmy Chain A

Receptor sequence

>2kmyA (length=107) Species: 876 (Desulfovibrio desulfuricans)

APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSG
CHDDLTAKKGEKSLYYVVHARGELKHTSCLACHSKVVAEKPELKKDLTGC
AKSKCHP

3D structure

• PDB: 2kmy Redox linked conformational changes in cytochrome c3 from Desulfovibrio desulfuricans ATCC 27774
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	P5 V11 F20 H22 H25 V28 C30 C33 H34	P5 V11 F20 H22 H25 V28 C30 C33 H34
BS02	HEC	A	H34 H35 K45 C46 C51 H52 E61 V67 L74 K75 H76	H34 H35 K45 C46 C51 H52 E61 V67 L74 K75 H76
BS03	HEC	A	F20 H25 C79 C82 H83 L97 K104	F20 H25 C79 C82 H83 L97 K104
BS04	HEC	A	L64 Y65 V68 H69 L80 T98 C100 C105 H106	L64 Y65 V68 H69 L80 T98 C100 C105 H106

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2kmy, PDBe:2kmy, PDBj:2kmy
• PDBsum: 2kmy
• PubMed: 20886839
• UniProt: B8J2Z0