Structure of PDB 2km0 Chain A |
>2km0A (length=74) Species: 266264 (Cupriavidus metallidurans CH34) [Search protein sequence] |
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGT KIIMKGNEIFRLDEALRKGHSEGG |
|
PDB | 2km0 CopK from Cupriavidus metallidurans CH34 Binds Cu(I) in a Tetrathioether Site: Characterization by X-ray Absorption and NMR Spectroscopy |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
M28 M38 M44 M54 |
M28 M38 M44 M54 |
|
|
|
|