Structure of PDB 2kkh Chain A |
>2kkhA (length=95) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVI VPSRTVIVVHDSLLISPFQIAKALNEARLEANVRVNGETSFKNKW |
|
PDB | 2kkh Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
7.2.2.12: P-type Zn(2+) transporter. 7.2.2.21: Cd(2+)-exporting ATPase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C27 C28 E31 |
C26 C27 E30 |
|
|
|
|