Structure of PDB 2kdx Chain A |
>2kdxA (length=119) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] |
GSMHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLFVSAF ETFREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKN VIITQGNEMRLLSLEMLAE |
|
PDB | 2kdx Structure of a nickel chaperone, HypA, from Helicobacter pylori reveals two distinct metal binding sites |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C76 C79 C93 C96 |
C76 C79 C93 C96 |
|
|
|
|