Structure of PDB 2k7r Chain A |
>2k7rA (length=106) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMI EKSLNKLYEYIEQSKNCSYCSEDENCNNLLEGYHPKLVVNGRSIDIEYYE CPVKRK |
|
PDB | 2k7r A novel zinc-binding fold in the helicase interaction domain of the Bacillus subtilis DnaI helicase loader |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C67 C70 H84 C101 |
C67 C70 H84 C101 |
|
|
|