Structure of PDB 2k6z Chain A |
>2k6zA (length=120) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
GSFTEGWVRFSPGPNAAAYLTLENPGDLPLRLVGARTPVAERVELHETFM REVEGKKVMGMRPVPFLEVPPKGRVELKPGGYHFMLLGLKRPLKAGEEVE LDLLFAGGKVLKVVLPVEAR |
|
PDB | 2k6z Mechanism of Cu(A) assembly. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H46 M61 H83 M85 |
H46 M61 H83 M85 |
|
|
|