Structure of PDB 2k3v Chain A

Receptor sequence

>2k3vA (length=86) Species: 318167 (Shewanella frigidimarina NCIMB 400) [Search protein sequence]

ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHK
PHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK

3D structure

PDB

2k3v The solution structure of a tetraheme cytochrome from Shewanella frigidimarina reveals a novel family structural motif

Chain

Resolution

N/A

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	A6 H9 V10 C15 C18 H19 E31 H65	A6 H9 V10 C15 C18 H19 E31 H65
BS02	HEC	A	L5 H9 Q34 C35 C38 H39	L5 H9 Q34 C35 C38 H39
BS03	HEC	A	L42 M45 H49 H52 L56 C58 C61 H62 K72 A85	L42 M45 H49 H52 L56 C58 C61 H62 K72 A85
BS04	HEC	A	H52 L55 L56 C61 C75 C78 H79 R83 A85	H52 L55 L56 C61 C75 C78 H79 R83 A85

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links

PDB	RCSB:2k3v, PDBe:2k3v, PDBj:2k3v
PDBsum	2k3v
PubMed	18950243
UniProt	O33731\|CYC3_SHEFN Tetraheme cytochrome c-type (Gene Name=cctA)