Structure of PDB 2k3r Chain A |
>2k3rA (length=91) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] |
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCK KCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK |
|
PDB | 2k3r Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
3.1.26.5: ribonuclease P. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C63 C66 C92 C95 |
C49 C52 C78 C81 |
|
|
|
|