Structure of PDB 2k1r Chain A |
>2k1rA (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
MGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDP KLQTPKTLQEAIDDMGFDAVIHN |
|
PDB | 2k1r The solution structure of the copper(I)-mediated complex between the first soluble domain of the Menkes protein and the metallochaperone HAH1. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
7.2.2.8: P-type Cu(+) transporter. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
C15 N16 C18 |
C15 N16 C18 |
|
|
|
|