Structure of PDB 2jwo Chain A

Receptor sequence

>2jwoA (length=82) Species: 10090 (Mus musculus)

GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVH
AQCMDLEERTLIHLSEGSNKYYCNEHVQIARA

3D structure

• PDB: 2jwo A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C419 C423 H455 C458	C14 C18 H50 C53
BS02	ZN	A	C446 H452 C478 H481	C41 H47 C73 H76

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:2jwo, PDBe:2jwo, PDBj:2jwo
• PDBsum: 2jwo
• PubMed: 15964836
• UniProt: P21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)