Structure of PDB 2jul Chain A

Receptor sequence
>2julA (length=181) Species: 10090 (Mus musculus) [Search protein sequence]
PEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQG
DATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYD
INKDGCITKEEMLAIMKSIYDMMGRHTYPILREDAPLEHVERFFQKMDRN
QDGVVTIDEFLETCQKDENIMNSMQLFENVI
3D structure
PDB2jul NMR structure of DREAM: Implications for Ca(2+)-dependent DNA binding and protein dimerization.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D175 N177 D179 C181 E186 D100 N102 D104 C106 E111
BS02 CA A D223 N225 D227 G228 V229 V230 E234 D148 N150 D152 G153 V154 V155 E159
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005267 potassium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006813 potassium ion transport
GO:0006915 apoptotic process
GO:0019233 sensory perception of pain
GO:0032026 response to magnesium ion
GO:0043523 regulation of neuron apoptotic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0048265 response to pain
GO:0048266 behavioral response to pain
GO:0071805 potassium ion transmembrane transport
GO:0072659 protein localization to plasma membrane
GO:1901379 regulation of potassium ion transmembrane transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0032993 protein-DNA complex
GO:0034702 monoatomic ion channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jul, PDBe:2jul, PDBj:2jul
PDBsum2jul
PubMed18201103
UniProtQ9QXT8|CSEN_MOUSE Calsenilin (Gene Name=Kcnip3)

[Back to BioLiP]