Structure of PDB 2ju4 Chain A

Receptor sequence

>2ju4A (length=87) Species: 9913 (Bos taurus)

MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGC
GDDIPGMEGCGTDITVICPWEACNHCELHELAQYGIC

3D structure

• PDB: 2ju4 Intrinsically disordered gamma-subunit of cGMP phosphodiesterase encodes functionally relevant transient secondary and tertiary structure.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RCY	A	C10 S12 A13	C10 S12 A13
BS02	RCY	A	V16 M17 C21	V16 M17 C21
BS03	RCY	A	C30 R33	C30 R33
BS04	RCY	A	R33 C38 C50 G51 D52 P55	R33 C38 C50 G51 D52 P55
BS05	RCY	A	C38 G49 C50 G51 D52	C38 G49 C50 G51 D52
BS06	RCY	A	C60 I64	C60 I64
BS07	RCY	A	I64 C68 W70	I64 C68 W70
BS08	RCY	A	P69 C73	P69 C73
BS09	RCY	A	C76 L78 H79 A82	C76 L78 H79 A82

Gene Ontology

Molecular Function

• GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity
• GO:0004117 calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0030553 cGMP binding
• GO:0047555 3',5'-cyclic-GMP phosphodiesterase activity
• GO:0048101 calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity
• GO:0060090 molecular adaptor activity

Biological Process

• GO:0007601 visual perception
• GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
• GO:0045745 positive regulation of G protein-coupled receptor signaling pathway

Cellular Component

• GO:0042622 photoreceptor outer segment membrane
• GO:0097381 photoreceptor disc membrane

External links

• PDB: RCSB:2ju4, PDBe:2ju4, PDBj:2ju4
• PDBsum: 2ju4
• PubMed: 18230733
• UniProt: P04972|CNRG_BOVIN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (Gene Name=PDE6G)