Structure of PDB 2jnd Chain A

Receptor sequence

>2jndA (length=79) Species: 10090 (Mus musculus)

YCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKY
NTTRNAYRECLENGTWASRVNYSHCEPIL

3D structure

• PDB: 2jnd Structure of the N-terminal domain of a type B1 G protein-coupled receptor in complex with a peptide ligand
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D65 Q66 I67 C84 P85 E86 F88 N89 I91 V113 Y115 C118 E119 P120	D22 Q23 I24 C41 P42 E43 F45 N46 I48 V70 Y72 C75 E76 P77

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity

Biological Process

• GO:0007186 G protein-coupled receptor signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:2jnd, PDBe:2jnd, PDBj:2jnd
• PDBsum: 2jnd
• PubMed: 17360332
• UniProt: Q60748|CRFR2_MOUSE Corticotropin-releasing factor receptor 2 (Gene Name=Crhr2)