Structure of PDB 2jkw Chain A |
>2jkwA (length=124) Species: 223 (Achromobacter cycloclastes) [Search protein sequence] |
ADFEVHMLNKGKDGAFVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIP DGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLE AVKGAKNPKKAQERLDAALAALGN |
|
PDB | 2jkw Pi-Interaction Tuning of the Active Site Properties of Metalloproteins. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|