Structure of PDB 2jk1 Chain A |
>2jk1A (length=138) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence] |
PAILLVDDEPHSLAAMKLALEDDFDVLTAQGAEAAIAILEEEWVQVIICD QRMPGRTGVDFLTEVRERWPETVRIIITGYTDSASMMAAINDAGIHQFLT KPWHPEQLLSSARNAARMFTLARENERLSLEMRLLERP |
|
PDB | 2jk1 The Hupr Receiver Domain Crystal Structure in its Nonphospho and Inhibitory Phospho States. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D13 D55 R57 |
D8 D50 R52 |
|
|
|
|