Structure of PDB 2jbh Chain A

Receptor sequence

>2jbhA (length=208) Species: 9606 (Homo sapiens)

EAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERL
AKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDF
IRLKMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIK
VASLLVKRTRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINE
HGKEKYRV

3D structure

• PDB: 2jbh Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E141 D142 G145 F194 R207
• Catalytic site (residue number reindexed from 1): E125 D126 G129 F177 R190
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PO4	A	K76 G77 R207	K70 G71 R190
BS02	CA	A	E141 D142	E125 D126
BS03	5GP	A	D142 V143 G145 T146 G147 T149 K173 F194 V195 D201	D126 V127 G129 T130 G131 T133 K157 F177 V178 D184

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0046038 GMP catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2jbh, PDBe:2jbh, PDBj:2jbh
• PDBsum: 2jbh
• PubMed: 21054786
• UniProt: Q9NRG1|PRDC1_HUMAN Phosphoribosyltransferase domain-containing protein 1 (Gene Name=PRTFDC1)