Structure of PDB 2j6s Chain A

Receptor sequence

>2j6sA (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2j6s Sulfolobus Solfataricus DNA Polymerase Dpo4 is Partially Inhibited by "Wobble" Pairing between O6- Methylguanine and Cytosine, But Accurate Bypass is Preferred.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S103 E106 K152 P184 G185 G187 I189 T190 S297 R298 T301 I341	S103 E106 K152 P184 G185 G187 I189 T190 S297 R298 T301 I341
BS02	dna	A	V32 A42 P60 A220 R242 K243 S244 G246 R247 I248 T250 R332	V32 A42 P60 A220 R242 K243 S244 G246 R247 I248 T250 R332
BS03	DTP	A	Y10 F11 Y12 A44 T45 R51 D105 K159	Y10 F11 Y12 A44 T45 R51 D105 K159
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	CA	A	D7 D105 E106	D7 D105 E106
BS06	CA	A	A181 I186	A181 I186

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2j6s, PDBe:2j6s, PDBj:2j6s
• PDBsum: 2j6s
• PubMed: 17105728
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)