Structure of PDB 2j6a Chain A

Receptor sequence

>2j6aA (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNI
VDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLL
LQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLVH

3D structure

PDB

2j6a The Zinc Finger Protein Ynr046W is Plurifunctional and a Component of the Erf1 Methyltransferase in Yeast.

Chain

Resolution

1.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C11 C16 C112 C115	C11 C16 C112 C115

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0008276	protein methyltransferase activity
GO:0016435	rRNA (guanine) methyltransferase activity
GO:0046982	protein heterodimerization activity
GO:0160102	tRNA (guanine(10)-N2)-methyltransferase activity

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002098	tRNA wobble uridine modification
GO:0030488	tRNA methylation
GO:0030490	maturation of SSU-rRNA
GO:0042273	ribosomal large subunit biogenesis
GO:0042274	ribosomal small subunit biogenesis
GO:0060566	positive regulation of termination of DNA-templated transcription
GO:0070476	rRNA (guanine-N7)-methylation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0035657	eRF1 methyltransferase complex
GO:0043527	tRNA methyltransferase complex
GO:0043528	tRNA (m2G10) methyltransferase complex

External links

PDB	RCSB:2j6a, PDBe:2j6a, PDBj:2j6a
PDBsum	2j6a
PubMed	17008308
UniProt	P53738\|TR112_YEAST Multifunctional methyltransferase subunit TRM112 (Gene Name=TRM112)