Structure of PDB 2j5m Chain A

Receptor sequence

>2j5mA (length=299) Species: 5474 (Leptoxyphium fumago) [Search protein sequence]

EEPGSGIGYPYDNNTLPYVAPGPTDSRAPCPALNALANHGYIPHDGRAIS
RETLQNAFLNHMGIANSVIELALTNAFVVCEYVTGSDCGDSLVNLTLLAE
PHAFEHDHSFSRKDYKQGVANSNDFIDNRNFDAETFQTSLDVVAGKTHFD
YADMNEIRLQRESLSNELDFPGWFTESKPIQNVESGFIFALVSDFNLPDN
DENPLVRIDWWKYWFTNESFPYHLGWHPPSPAREIEFVTSASSAVLAASV
TSTPSSLPSGAIGPGAEAVPLSFASTMTPFLLATNAPYYAQDPTLGPND

3D structure

PDB

2j5m Structure and Quantum Chemical Characterization of Chloroperoxidase Compound 0, a Common Reaction Intermediate of Diverse Heme Enzymes.

Chain

Resolution

1.75 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C29 H105 D106 E183
Catalytic site (residue number reindexed from 1)	C30 H106 D107 E184
Enzyme Commision number	1.11.1.10: chloride peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MN	A	E104 H105 S108	E105 H106 S109
BS02	HEM	A	P28 C29 P30 A31 L32 F57 I63 A71 F103 E104 H105 S108 F109 S110 E183 F186 I187 W213 F214	P29 C30 P31 A32 L33 F58 I64 A72 F104 E105 H106 S109 F110 S111 E184 F187 I188 W214 F215
BS03	MAN	A	T238 E266	T239 E267
BS04	MAN	A	Y150 D200 E201 F236 S239	Y151 D201 E202 F237 S240
BS05	MAN	A	P178 V182 T238 S241 L245 G264 A265	P179 V183 T239 S242 L246 G265 A266
BS06	MAN	A	D152 T250	D153 T251
BS07	MAN	A	V141 Q159 S251 P253	V142 Q160 S252 P254
BS08	MAN	A	V249 T252	V250 T253

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity

View graph for
Molecular Function

External links

PDB	RCSB:2j5m, PDBe:2j5m, PDBj:2j5m
PDBsum	2j5m
PubMed	17190816
UniProt	P04963\|PRXC_LEPFU Chloroperoxidase (Gene Name=CPO)

[Back to BioLiP]