Structure of PDB 2j0u Chain A

Receptor sequence

>2j0uA (length=366) Species: 9606 (Homo sapiens) [Search protein sequence]

PTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTG
KTATFSVSVLQCLDIQVRETQALILAPTRELAVQVQKGLLALGDYMNVQC
HACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLD
EADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPI
RILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDITQAVIFCNTKRKV
DWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARD
VPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAVNFVKNDDIRVLRDI
EQYYSTQIDEMPMNVA

3D structure

PDB

2j0u The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T178 Y202 Y205 R206 Y207 L208 P209 K231 F232	T141 Y165 Y168 R169 Y170 L171 P172 K194 F195

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003724	RNA helicase activity
GO:0003729	mRNA binding
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008143	poly(A) binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0035368	selenocysteine insertion sequence binding
GO:0035613	RNA stem-loop binding
GO:0043021	ribonucleoprotein complex binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398	mRNA splicing, via spliceosome
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0006406	mRNA export from nucleus
GO:0006417	regulation of translation
GO:0008306	associative learning
GO:0008380	RNA splicing
GO:0010629	negative regulation of gene expression
GO:0014070	response to organic cyclic compound
GO:0017148	negative regulation of translation
GO:0035640	exploration behavior
GO:0045727	positive regulation of translation
GO:0048701	embryonic cranial skeleton morphogenesis
GO:0051028	mRNA transport
GO:0072715	cellular response to selenite ion
GO:0090394	negative regulation of excitatory postsynaptic potential
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission
GO:1904570	negative regulation of selenocysteine incorporation
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
GO:2000622	regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0016607	nuclear speck
GO:0030425	dendrite
GO:0035145	exon-exon junction complex
GO:0043025	neuronal cell body
GO:0071006	U2-type catalytic step 1 spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2j0u, PDBe:2j0u, PDBj:2j0u
PDBsum	2j0u
PubMed	16923391
UniProt	P38919\|IF4A3_HUMAN Eukaryotic initiation factor 4A-III (Gene Name=EIF4A3)

[Back to BioLiP]