Structure of PDB 2iwi Chain A

Receptor sequence
>2iwiA (length=244) Species: 9606 (Homo sapiens) [Search protein sequence]
YRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLVTCPLEVALLWK
VGAGGGHPGVIRLLDWFFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFF
GQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPY
TDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEI
LEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQT
3D structure
PDB2iwi Crystal structure of the PIM2 kinase in complex with an organoruthenium inhibitor.
ChainA
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D163 K165 N168 D182 T200
Catalytic site (residue number reindexed from 1) D119 K121 N124 D138 T156
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HB1 A G39 F43 V46 L116 E117 R118 D124 E167 L170 I181 G8 F12 V15 L72 E73 R74 D80 E123 L126 I137
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0007346 regulation of mitotic cell cycle
GO:0008285 negative regulation of cell population proliferation
GO:0008637 apoptotic mitochondrial changes
GO:0009615 response to virus
GO:0010508 positive regulation of autophagy
GO:0016236 macroautophagy
GO:0016239 positive regulation of macroautophagy
GO:0016310 phosphorylation
GO:0043066 negative regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045893 positive regulation of DNA-templated transcription
GO:0050821 protein stabilization
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2iwi, PDBe:2iwi, PDBj:2iwi
PDBsum2iwi
PubMed19841674
UniProtQ9P1W9|PIM2_HUMAN Serine/threonine-protein kinase pim-2 (Gene Name=PIM2)

[Back to BioLiP]