Structure of PDB 2ime Chain A

Receptor sequence

>2imeA (length=203) Species: 303 (Pseudomonas putida)

MIVDFYFDFLSPFSYLANQRLSKLAQDYGLTIRYNAIDLARVKIAIGNVG
PSNRDLKVKLDYLKVDLQRWAQLYGIPLVFPANYNSRRMNIGFYYSGAEA
QAAAYVNVVFNAVWGEGIAPDLESLPALVSEKLGWDRSAFEHFLSSNAAT
ERYDEQTHAAIERKVFGVPTMFLGDEMWWGNDRLFMLESAMGRLCRQNAD
LSS

3D structure

• PDB: 2ime 2-Hydroxychromene-2-carboxylic Acid Isomerase: A Kappa Class Glutathione Transferase from Pseudomonas putida
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S11 V168 W179 N181 D182
• Catalytic site (residue number reindexed from 1): S11 V168 W179 N181 D182
• Enzyme Commision number: 5.99.1.4: 2-hydroxychromene-2-carboxylate isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	S11 F13 G167 V168 W179 G180 N181 D182	S11 F13 G167 V168 W179 G180 N181 D182	MOAD: Kd=14uM
BS02	TOH	A	P12 F13 R54 L63 Y84	P12 F13 R54 L63 Y84	MOAD: Ki=136uM
BS03	2C2	A	P12 F13 S52 N53 R54	P12 F13 S52 N53 R54	MOAD: Kd=19uM

Gene Ontology

Molecular Function

• GO:0004364 glutathione transferase activity
• GO:0004602 glutathione peroxidase activity
• GO:0016491 oxidoreductase activity
• GO:0016853 isomerase activity
• GO:0018845 2-hydroxychromene-2-carboxylate isomerase activity

Biological Process

• GO:0006749 glutathione metabolic process
• GO:0009056 catabolic process
• GO:0098869 cellular oxidant detoxification
• GO:1901170 naphthalene catabolic process

Cellular Component

• GO:0005777 peroxisome

External links

• PDB: RCSB:2ime, PDBe:2ime, PDBj:2ime
• PDBsum: 2ime
• PubMed: 17508726
• UniProt: Q51948|NAHD_PSEPU 2-hydroxychromene-2-carboxylate isomerase (Gene Name=nahD)