Structure of PDB 2iim Chain A |
>2iimA (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQ EGFIPFNFVAKA |
|
PDB | 2iim Crystal structure analysis and solution studies of human Lck-SH3; zinc-induced homodimerization competes with the binding of proline-rich motifs. |
Chain | A |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.10.2: non-specific protein-tyrosine kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H76 D79 |
H19 D22 |
|
|
|