Structure of PDB 2ihn Chain A

Receptor sequence

>2ihnA (length=299) Species: 10665 (Tequatrovirus T4)

MDLEMMLDEDYKEGICLIDFSQIALSTALVNFPDKEKINLSMVRHLILNS
IKFNVKKAKTLGYTKIVLCIDNAKSGYWRRDFAYYYKKNRSTWDWEGYFE
SSHKVIDELKAYMPYIVMDIDKYEANDHIAVLVKKFSLEGHKILIISSDG
DFTQLHKYPNVKQWSPMHKKWVKIKSGSAEIDCMTKILKGDKKDNVASVK
VRSDFWFTRVEGERTPSMKTSIVEAIANDREQAKVLLTESEYNRYKENLV
LIDFDYIPDNIASNIVNYYNSYKLPPRGKIYSYFVKAGLSKLTNSINEF

3D structure

• PDB: 2ihn Crystal structure of bacteriophage T4 5' nuclease in complex with a branched DNA reveals how FEN-1 family nucleases bind their substrates.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.4: ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q22 S26 L29 A73 K74 W101 F105 H109 S154 G156 K176 K181 K199	Q22 S26 L29 A73 K74 W95 F99 H103 S148 G150 K170 K175 K193
BS02	dna	A	T27 V30 S50 K52 F53 K56 M173 H174 K175 K195 R220 T221 M224 T226 K297 L298 N300 S301	T27 V30 S50 K52 F53 K56 M167 H168 K169 K189 R214 T215 M218 T220 K291 L292 N294 S295

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0004519 endonuclease activity
• GO:0004523 RNA-DNA hybrid ribonuclease activity
• GO:0004527 exonuclease activity
• GO:0004534 5'-3' RNA exonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0017108 5'-flap endonuclease activity

Biological Process

• GO:0006260 DNA replication
• GO:0033567 DNA replication, Okazaki fragment processing
• GO:0043137 DNA replication, removal of RNA primer

External links

• PDB: RCSB:2ihn, PDBe:2ihn, PDBj:2ihn
• PDBsum: 2ihn
• PubMed: 17693399
• UniProt: P13319|RNH_BPT4 Ribonuclease H (Gene Name=rnh)