Structure of PDB 2ig3 Chain A

Receptor sequence

>2ig3A (length=127) Species: 197 (Campylobacter jejuni)

MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKI
GNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNE
EMKNVILQRAQMIASHFQNMLYKYGGH

3D structure

• PDB: 2ig3 Structural determinants in the group III truncated hemoglobin from Campylobacter jejuni.
• Chain: A
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F32 I36 K49 I50 F53 Y64 K71 H72 L75 F78 F82 F83 W86 I113 F117	F32 I36 K49 I50 F53 Y64 K71 H72 L75 F78 F82 F83 W86 I113 F117

Gene Ontology

Molecular Function

• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ig3, PDBe:2ig3, PDBj:2ig3
• PDBsum: 2ig3
• PubMed: 17023416
• UniProt: Q0PB48|TRHBP_CAMJE Group 3 truncated hemoglobin ctb (Gene Name=ctb)