Structure of PDB 2icp Chain A |
>2icpA (length=87) Species: 199310 (Escherichia coli CFT073) [Search protein sequence] |
RPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS VVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ |
|
PDB | 2icp Crystal structure of the bacterial antitoxin HigA from Escherichia coli. |
Chain | A |
Resolution | 1.88 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
I33 T37 |
I26 T30 |
|
|
|
|