Structure of PDB 2ibw Chain A

Receptor sequence
>2ibwA (length=391) Species: 9606 (Homo sapiens) [Search protein sequence]
PTLKEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEV
KEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMA
SQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD
VYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVI
PVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTL
NDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMV
LKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHP
IGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQKL
3D structure
PDB2ibw Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C126 H385 C413 G415
Catalytic site (residue number reindexed from 1) C90 H349 C377 G379
Enzyme Commision number 2.3.1.9: acetyl-CoA C-acetyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 K A Y219 A280 A281 N282 A283 S284 V381 Y183 A244 A245 N246 A247 S248 V345
BS02 COA A L184 M193 Y219 V259 D260 K263 L267 A281 S284 F325 A355 F356 H385 L148 M157 Y183 V223 D224 K227 L231 A245 S248 F289 A319 F320 H349
Gene Ontology
Molecular Function
GO:0003985 acetyl-CoA C-acetyltransferase activity
GO:0003988 acetyl-CoA C-acyltransferase activity
GO:0016453 C-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0019899 enzyme binding
GO:0030955 potassium ion binding
GO:0034736 cholesterol O-acyltransferase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0120225 coenzyme A binding
Biological Process
GO:0001889 liver development
GO:0006085 acetyl-CoA biosynthetic process
GO:0006550 isoleucine catabolic process
GO:0006631 fatty acid metabolic process
GO:0006635 fatty acid beta-oxidation
GO:0009725 response to hormone
GO:0014070 response to organic cyclic compound
GO:0015936 coenzyme A metabolic process
GO:0015937 coenzyme A biosynthetic process
GO:0042594 response to starvation
GO:0046356 acetyl-CoA catabolic process
GO:0046952 ketone body catabolic process
GO:0060612 adipose tissue development
GO:0072229 metanephric proximal convoluted tubule development
GO:1902224 ketone body metabolic process
GO:1902860 propionyl-CoA biosynthetic process
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005783 endoplasmic reticulum
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ibw, PDBe:2ibw, PDBj:2ibw
PDBsum2ibw
PubMed17371050
UniProtP24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial (Gene Name=ACAT1)

[Back to BioLiP]