Structure of PDB 2ibf Chain A

Receptor sequence

>2ibfA (length=258) Species: 9606 (Homo sapiens)

MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TSWDEDAW

3D structure

• PDB: 2ibf Vinculin binding in its closed conformation by a helix addition mechanism.
• Chain: A
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T8 I12 V16 Q19 I20 K35 I37 P38 L40 P43 V44 V47 A50 L54 V57 T61 S112 I115 L123 F126 E130	T8 I12 V16 Q19 I20 K35 I37 P38 L40 P43 V44 V47 A50 L54 V57 T61 S112 I115 L123 F126 E130
BS02	peptide	A	M154 L157 V158 K162 G165 T169 K199 K210	M154 L157 V158 K162 G165 T169 K199 K210

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0005198 structural molecule activity
• GO:0051015 actin filament binding

Biological Process

• GO:0007155 cell adhesion

Cellular Component

• GO:0015629 actin cytoskeleton

External links

• PDB: RCSB:2ibf, PDBe:2ibf, PDBj:2ibf
• PDBsum: 2ibf
• PubMed: 17932491
• UniProt: P18206|VINC_HUMAN Vinculin (Gene Name=VCL)