Structure of PDB 2ia6 Chain A

Receptor sequence

>2ia6A (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2ia6 A structural gap in Dpo4 supports mutagenic bypass of a major benzo[a]pyrene dG adduct in DNA through template misalignment.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G185 G187 I189 T190 R298 T301	G185 G187 I189 T190 R298 T301
BS02	dna	A	Y12 V32 K78 G218 A220 R242 K243 S244 I245 R247 R332 R336	Y12 V32 K78 G218 A220 R242 K243 S244 I245 R247 R332 R336
BS03	dna	A	E79 V80 Q83 R87	E79 V80 Q83 R87
BS04	dna	A	V18 R87 K135	V18 R87 K135
BS05	CA	A	D7 F8 D105	D7 F8 D105
BS06	CA	A	A181 I186	A181 I186
BS07	ATP	A	D7 Y10 F11 T45 R51 A57 K159	D7 Y10 F11 T45 R51 A57 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2ia6, PDBe:2ia6, PDBj:2ia6
• PDBsum: 2ia6
• PubMed: 17848527
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)