Structure of PDB 2i3p Chain A

Receptor sequence
>2i3pA (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDGDGSIIAQIRPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
3D structure
PDB2i3p Homing endonuclease I-CreI derivatives with novel DNA target specificities.
ChainA
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G19 D20 G21 S22 I24 Q26 R28 Q44 T46 Q47 K48 R70 N136 D137 S138 R141 K142 G18 D19 G20 S21 I23 Q25 R27 Q43 T45 Q46 K47 R69 N135 D136 S137 R140 K141
BS02 dna A S32 Y33 K34 Q38 R68 R70 E80 I81 K116 K139 S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i3p, PDBe:2i3p, PDBj:2i3p
PDBsum2i3p
PubMed16971456
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]