Structure of PDB 2i2r Chain A |
>2i2rA (length=129) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
AGVAAWLPFARAAAIGWMANCPMNKRQDELIVLNVSGRRFQTWRTTLERY PDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECI SAYDDELAFYGILPEIIGDCCYEEYKDRK |
|
PDB | 2i2r Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer |
Chain | A |
Resolution | 3.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H104 C131 C132 |
H93 C120 C121 |
|
|
|
|