Structure of PDB 2hx9 Chain A |
>2hx9A (length=124) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLST AADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKL KEEQYMFFCSPHQGAGMKGTLTLK |
|
PDB | 2hx9 Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H46 C112 H115 |
H44 C109 H112 |
|
|
|
|