Structure of PDB 2hx0 Chain A |
>2hx0A (length=138) [Search protein sequence] |
HHNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVAL RYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPG CTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL |
|
PDB | 2hx0 Three-dimensional structure of the hypothetical protein from Salmonella cholerae-suis (aka Salmonella enterica) at the resolution 1.55 A. Northeast Structural Genomics target ScR59. |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
H84 H86 H100 |
H80 H82 H96 |
|
|
|
|