Structure of PDB 2hvy Chain A

Receptor sequence

>2hvyA (length=320) Species: 2261 (Pyrococcus furiosus)

RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGP
TSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAG
KEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLLRTRKVYYIEVLEIE
GRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETL
ITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVT
HGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTK
GIAVDVEKVFMPRDWYPKLW

3D structure

• PDB: 2hvy Crystal structure of an H/ACA box ribonucleoprotein particle
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 5.4.99.25: tRNA pseudouridine(55) synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	G59 H63 E64 H80 R101 L107 K259 S261 A262 A265 H268 G269 A270 A273 P275 G276 K317 G318 I319 K325 V326 R330 K335 W337	G49 H53 E54 H70 R91 L97 K242 S244 A245 A248 H251 G252 A253 A256 P258 G259 K300 G301 I302 K308 V309 R313 K318 W320
BS02	ATP	A	H118 H120 R169 H199	H108 H110 R152 H182

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0160148 tRNA pseudouridine(55) synthase activity

Biological Process

• GO:0000495 box H/ACA sno(s)RNA 3'-end processing
• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031118 rRNA pseudouridine synthesis
• GO:0031119 tRNA pseudouridine synthesis
• GO:0031120 snRNA pseudouridine synthesis
• GO:1990481 mRNA pseudouridine synthesis

External links

• PDB: RCSB:2hvy, PDBe:2hvy, PDBj:2hvy
• PDBsum: 2hvy
• PubMed: 16943774
• UniProt: Q7LWY0|TRUB_PYRFU Probable tRNA pseudouridine synthase B (Gene Name=truB)