Structure of PDB 2huh Chain A |
>2huhA (length=147) Species: 818 (Bacteroides thetaiotaomicron) [Search protein sequence] |
RQPEVRGGDTLNVFLAYVPEDAKAMMTTPFEAYLVNDSNYYLYYTYLSAE GKAWNNRSHGLVEPNTKLLLEEFTKDVLNEMERVAVQLIAFKDGKPAAIK PAVSVELRIDTVKFYKLHTFSASDFFEEPALIYDIVKDDVPAKQVYV |
|
PDB | 2huh Crystal structure of putative DNA Mismatch Repair Protein (NP_811092.1) from Bacteroides Thetaiotaomicron VPI-5482 at 1.54 A resolution |
Chain | A |
Resolution | 1.54 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
S203 F206 |
S123 F126 |
|
|
|