Structure of PDB 2hr1 Chain A

Receptor sequence

>2hr1A (length=327) Species: 735 (Haemophilus parahaemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 2hr1 The Role of Arg165 Towards Base Flipping, Base Stabilization and Catalysis in M.HhaI.
• Chain: A
• Resolution: 1.96 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y44 I86 Q90 N123 K234 G236 Q237 G256 G257 S294 Q297	Y44 I86 Q90 N123 K234 G236 Q237 G256 G257 S294 Q297	PDBbind-CN: Kd=190pM
BS02	dna	A	F79 C81 S85 I86 S87 G88 K89 R97 E119 V121 K162 R165 R228 Q237 R240 Y242 I249 T250 A253 Y254 G255 G256 N304	F79 C81 S85 I86 S87 G88 K89 R97 E119 V121 K162 R165 R228 Q237 R240 Y242 I249 T250 A253 Y254 G255 G256 N304	PDBbind-CN: Kd=190pM
BS03	SAH	A	F18 A19 G20 L21 G23 E40 W41 D60 I61 G78 N304 S305	F18 A19 G20 L21 G23 E40 W41 D60 I61 G78 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2hr1, PDBe:2hr1, PDBj:2hr1
• PDBsum: 2hr1
• PubMed: 16926025
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)