Structure of PDB 2hn9 Chain A

Receptor sequence

>2hn9A (length=253) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

MSKSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREF
TSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQP
HINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGAT
THVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESA
TLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAAR
RLL

3D structure

• PDB: 2hn9 Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with thymine and phosphate ion at 2.12A resolution
• Chain: A
• Resolution: 2.12 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R1030 R1048 R1091 R1168 I1220 V1221
• Catalytic site (residue number reindexed from 1): R30 R48 R91 R168 I220 V221
• Enzyme Commision number: 2.4.2.3: uridine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TDR	A	G1096 F1162 Q1166 R1168 I1220	G96 F162 Q166 R168 I220

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004850 uridine phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0047847 deoxyuridine phosphorylase activity

Biological Process

• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009166 nucleotide catabolic process
• GO:0044206 UMP salvage

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2hn9, PDBe:2hn9, PDBj:2hn9
• PDBsum: 2hn9
• UniProt: P0A1F6|UDP_SALTY Uridine phosphorylase (Gene Name=udp)