Structure of PDB 2hm9 Chain A

Receptor sequence

>2hm9A (length=162) Species: 1582 (Lacticaseibacillus casei)

TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFP
KRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGA
QIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPA
LTHTYEVWQKKA

3D structure

• PDB: 2hm9 NMR structures of apo L.casei dihydrofolate reductase and its complexes with trimethoprim and NADPH. Contributions to positive cooperative binding from ligand-induced refolding, conformational changes and interligand hydrophobic interactions
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): L4 L19 W21 D26 L27 F30 L54 L94 T116
• Catalytic site (residue number reindexed from 1): L4 L19 W21 D26 L27 F30 L54 L94 T116
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TRR	A	L4 W5 A6 G17 H18 L19 D26 L27 Y29 F30 S48	L4 W5 A6 G17 H18 L19 D26 L27 Y29 F30 S48

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0031427 response to methotrexate
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2hm9, PDBe:2hm9, PDBj:2hm9
• PDBsum: 2hm9
• PubMed: 21410224
• UniProt: P00381|DYR_LACCA Dihydrofolate reductase (Gene Name=folA)