Structure of PDB 2hip Chain A

Receptor sequence

>2hipA (length=71) Species: 1053 (Halorhodospira halophila)

EPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTH
PDFDEVLVKAEGWCSVYAPAS

3D structure

• PDB: 2hip The molecular structure of the high potential iron-sulfur protein isolated from Ectothiorhodospira halophila determined at 2.5-A resolution.
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C31 C34 F36 C48 C64	C31 C34 F36 C48 C64

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0019646 aerobic electron transport chain

External links

• PDB: RCSB:2hip, PDBe:2hip, PDBj:2hip
• PDBsum: 2hip
• PubMed: 1917989
• UniProt: P04168|HIP1_HALHA High-potential iron-sulfur protein isozyme 1 (Gene Name=hip1)