Structure of PDB 2hgs Chain A

Receptor sequence

>2hgsA (length=472) Species: 9606 (Homo sapiens) [Search protein sequence]

TNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTL
FPSLVPSALLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTAR
LFDIHKQVLKEGIAQTVFLGLNRSDYMFQRSADGSPALKQIEINTISASF
GGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAWELYGSP
NALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQDR
RLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLA
GTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIA
EALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIE
PEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTK
AIEHADGGVAAGVAVLDNPYPV

3D structure

PDB

2hgs Molecular basis of glutathione synthetase deficiency and a rare gene permutation event.

Chain

Resolution

2.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	R125 E144 N146 S151 K305 K364 E368 G369 R450
Catalytic site (residue number reindexed from 1)	R123 E142 N144 S149 K303 K362 E366 G367 R448
Enzyme Commision number	6.3.2.3: glutathione synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	A	E144 N146 E368	E142 N144 E366
BS02	SO4	A	R412 R418 H456	R410 R416 H454
BS03	SO4	A	R125 E144 N146 G369 R450	R123 E142 N144 G367 R448
BS04	ADP	A	I143 E144 K305 V362 K364 E368 G369 G370 N373 Y375 K400 I401 E425 K452 D458	I141 E142 K303 V360 K362 E366 G367 G368 N371 Y373 K398 I399 E423 K450 D456
BS05	GSH	A	I148 S149 A150 S151 F152 E214 N216 Q220 R267 Y270 R450 V461 A462	I146 S147 A148 S149 F150 E212 N214 Q218 R265 Y268 R448 V459 A460

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004363	glutathione synthase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016874	ligase activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0043295	glutathione binding
GO:0046872	metal ion binding

	Biological Process
GO:0006520	amino acid metabolic process
GO:0006750	glutathione biosynthetic process
GO:0006979	response to oxidative stress
GO:0007399	nervous system development
GO:0046686	response to cadmium ion

	Cellular Component
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2hgs, PDBe:2hgs, PDBj:2hgs
PDBsum	2hgs
PubMed	10369661
UniProt	P48637\|GSHB_HUMAN Glutathione synthetase (Gene Name=GSS)

[Back to BioLiP]