Structure of PDB 2hgh Chain A

Receptor sequence

>2hghA (length=87) Species: 8355 (Xenopus laevis) [Search protein sequence]

MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLK
RHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD

3D structure

PDB

2hgh Induced Fit and 'Lock and Key' Recognition of 5 S RNA by Zinc Fingers of Transcription Factor IIIA

Chain

Resolution

N/A

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y105 K117 K118 H119 N120 Q121 K123 K144 F146 L148 S150 R151 K153 R154 H155 V158 Y162 T176 W177 T178 K182	Y2 K14 K15 H16 N17 Q18 K20 K41 F43 L45 S47 R48 K50 R51 H52 V55 Y59 T73 W74 T75 K79	PDBbind-CN: Kd=8nM
BS02	ZN	A	C107 C112 H125 H129	C4 C9 H22 H26
BS03	ZN	A	C137 C142 H155 H159	C34 C39 H52 H56
BS04	ZN	A	C164 C170 H183 H188	C61 C67 H80 H85

External links

PDB	RCSB:2hgh, PDBe:2hgh, PDBj:2hgh
PDBsum	2hgh
PubMed	16405997
UniProt	P03001\|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)